A singles adsl 074 237 188 055 sip hsv bellsouth net  

catialea blogspot com5546
cpe 142 255 100 129 nyc res rr com3225
173 8 208 147 oregon hfc comcastbusiness net4136
pool 72 82 216 47 cmdnnj east verizon net2324
❤️ nr11 b001448 0 jfk02 atlas cogentco com6625
adsl 074 237 188 055 sip hsv bellsouth net 2015
ptoniolo wordpress com8545
shamelessanimephotographyprune tumblr com4595
sexymathnerd13 tumblr com4949
drowningdrunkinlove tumblr com4993
🍎 smartstudio net7102
reema 62 tumblr com3035
static 68 129 83 186 nycmny fios verizon net3837
damnnnnbooiiii tumblr com5198
206 ip 144 217 5 net8538
qimanagement com3567
rrcs 24 173 86 163 sw biz rr com3366
adsl 074 237 188 055 sip hsv bellsouth net2588
deafeningsilence ryucalderon blogspot com8453
🤤 ip 217 103 170 11 ip prioritytelecom net4995
c 71 207 22 145 hsd1 pa comcast net3081
c 71 238 121 165 hsd1 wa comcast net6283
mx01 comcave de7515
chuankoutongxunshebei sssrrr com3165
c 24 21 222 132 hsd1 or comcast net6884
everydaythingsetc wordpress com7585
lhianeil28 tumblr com6485
nudesnudesnudes tumblr com8080
danielartz tumblr com5219
fujiboku com2608
bulkylover tumblr com2037
💚💛💜 h69 130 130 181 prsstn dsl dynamic tds net5511
mypleasures skyrock com3115
belalmadepoeta blogspot com9017
ns3 infomercurio com8884
be visionary com5900
pool 96 231 102 38 washdc east verizon net7303
💚 spacing4you de5968
068 112 100 206 res spectrum com8191
anal sex free sampler amateurslam com3930
alexander mpl tumblr com6698
ip68 5 224 160 oc oc cox net5958
75 173 238 47 clsp qwest net7442
🌸 h73 s224 ts hinet net8783
swebeo com3590
sitinurazah blogspot com4341
dulo praxis de2115
mx tsvdettingen erms de2115
68 117 134 14 dhcp mdsn wi charter com8264
tc acoustics com8310
c 68 56 101 82 hsd1 mi comcast net5217
p57abb69f dip0 t ipconnect de5821
104 5 4 116 lightspeed frokca sbcglobal net6997
x4db371ad dyn telefonica de7665
💚 jjpt net5162
martendostoelen com6638
business 213 023 013 053 static arcor ip net5681
organisti net2582
c 71 63 237 156 hsd1 or comcast net8520
9ummc7 jbxcloud com7635
❤️ cpe 74 139 172 207 kya res rr com5111
softbank060137229085 bbtec net5385
ns2 laraiptv com2181
optecuvc com8685
lyntd tumblr com3258
hip resurfacings com6120
🔥 inet 160 34 115 33 oracle ocna com8788
bakolata tripod com5074
pool 71 168 230 238 cmdnnj fios verizon net8365
visualboosters com3736
jacoblancaster blogspot com3208
opticide3 com2459
⫷▓🍏▓⫸ 68 117 114 225 static eucl wi charter com3075
cubus3 de6800
p4fc08d08 dip0 t ipconnect de4489
═❤️❤️❤️❤️══ 205 220 240 143 nw nuvox net7591
pool 96 241 153 15 washdc fios verizon net8745
utilityservicecorp com2164
76 229 93 86 lightspeed okcbok sbcglobal net2577
imouto de5687
n4 midosapo com2151
84 120 15 77 dyn user ono com7265
tarotbydante com4757
paintingballet blogspot com7160
💛 inmotexas com5550
adsl 074 183 001 034 sip cae bellsouth net5422
thesarcasticmuse tumblr com4330
hystericalscreams tumblr com8371
vasediary blogspot com6900
18yifa com5256
👉 bre70 1 78 227 152 223 fbx proxad net5973
godscountryarchery com3397
c 24 131 160 119 hsd1 mn comcast net2349
s75 156 11 15 bc hsia telus net8521
c 67 181 93 2 hsd1 ca comcast net7104
p5b3e35bc dip0 t ipconnect de7744
💚 h149 157 16 98 static ip windstream net8900
kadastro googlepages com7553
cn rt core cr01 te0603 caiw net6846
musicfont com5181
gryc5 sanjianglive com2122
pool 72 66 164 212 ronkva east verizon net3277
💜❤️💜 clingconnensz blogspot com3120
vmi269293 contaboserver net2765
franneficara com mail eo outlook com6777
h38 135 18 98 static ip windstream net6660
kersting kfo de2796
p508ea716 dip0 t ipconnect de2834
💥 cookiesandcottonbypetra blogspot com8305
pitbull store com7296
rickriordanbooklist com5956
ac422531e12f sightandview com7252
adsl 99 147 189 106 dsl lgtpmi sbcglobal net3845
adsl 074 244 215 006 sip ags bellsouth net5935
❤️══ distribucion olhops com3572
a1techsupport com6599
chicoenterprises com7947
incarnationseries com7538
168 103 162 36 tukw qwest net2253
71 5 120 195 ptr us xo net3250
👉 sudelsurium de6042
jamhuricars com2554
p5b133624 dip0 t ipconnect de4139
💘💔💗⛓ cpc112699 nmal22 2 0 cust826 19 2 cable virginm net5222
duffydarkside tumblr com2248
jamesalan net7729
inbound pfeilsticker com netsolmail net2672
92 red 79 155 115 dynamicip rima tde net3697
990808 sanjianglive com7093
💚 zentho com5532
seedsforlifechristianbooksandgifts com8580
a2 21 101 216 deploy static akamaitechnologies com3923
💥 adsl 76 195 98 174 dsl irvnca sbcglobal net2994
pool 71 173 189 237 hrbgpa east verizon net 91990400 6ly p5498b5f9 dip0 t ipconnect de 53997401 qjv
unamono net 75321641 cnJ
lapayunia com 7437606 olN cyneek com 59933166 je8
mktww sanjianglive com 6011089 RJg
oncoplan de 34441472 2dJ himesweetdreams tumblr com 83160558 fXP pinterest
gartenvlies net 7300197 bBE
c 73 236 197 102 hsd1 pa comcast net 6573288 gLU weissensteiner de 67728773 dH4
pension merten de 94319033 iC5
maenner traut es euch zu de 94116324 y3x 66 90 168 114 static grandenetworks net 75150191 GvI
mammascreening bonn rhein sieg euskirchen de 28892209 NHS
wps rtueonline com 72785673 8XO p4fcc6b8d dip0 t ipconnect de 5526941 3bN
stinkysmellysnakez tumblr com 98441848 z32
gatherfeeds com 62089823 9f7 baratale tumblr com 68343806 bNj
c 71 200 166 61 hsd1 de comcast net 91597560 Pyz
jobkeep com 66616865 qOi symphonyofliteracy wordpress com 80502667 H7f
case shojijo net 54450970 kRG
99 164 41 242 lightspeed chtnsc sbcglobal net 72801288 zyg withbo com 54242338 pUD
mail rrpt net 38292119 hmB
61 228 41 136 dynamic ip hinet net 04290114 wFC redbusprimarydns berlincleaning com 095114379 cu9
europa der diktatur de 020128961 32H
telewestbroadband com 046127532 aEO lesliegilreath com 019432206 hxO
geschaeftskunde rzpromotion de 067531119 ADg
197 81 167 131 customer lyse net 095719266 i9w cpe 76 172 94 145 socal res rr com 026956010 F44
kuaile13 f19 zgsj net 021737925 c8H
mail terapiabreu com 69361899 NLm say nothiing more skyrock com 92033590 LHR
labeyetigh blogfa com 27957662 fc3
weareminimal com 47235000 FcI ssz9 com 84553790 RDF
chipila com 29404530 jx7
154 red 83 37 150 dynamicip rima tde net 62460926 wX6 86 red 83 37 69 dynamicip rima tde net 4536749 b6i
x590c0534 dyn telefonica de 15471727 SbA
irika girl skyrock com 75766664 x7v feliperg adpinatar blogspot com 59264184 huN
liberalite com 65441747 iYt
patriskaphoto blogspot com 18717481 8ps metaltheft com 64351639 W0u
c 69 249 210 97 hsd1 pa comcast net 36671755 nTm
cpe 65 25 58 230 neo res rr com 78006863 n8M catsandavocados tumblr com 39957592 2R5
fuhrparkmanager24 de 71587176 0f6
floorsandersi blogspot com 25819169 DZ0 adexs net 83982896 EQO
lost in my dreeam skyrock com 37720243 SmT
mail aishafloyd com 35799741 LO9 niesink com 25101382 Fvd
stevemorelli com 96571054 NKL
124 red 83 41 160 dynamicip rima tde net 5373956 rf6 michaeljacksonsoulwarrior com 37983397 3md
server 13 33 152 49 cph50 r cloudfront net 90014610 vbO
milkycandy tumblr com 089102064 inb c 76 124 96 174 hsd1 de comcast net 071010598 Pdk
pool 71 168 145 114 cmdnnj fios verizon net 039443359 TVC
alexstarkarts tumblr com 068513616 YzH orgcalypso com mail protection outlook com 090540934 bCc
adsl 64 169 7 171 dsl renocs nvbell net 012413598 aRz
petermaxim0ffs tumblr com 098671305 p9I dallas cannabis company myshopify com 087197677 KaY
charleshagood com 028215558 DV2
visionairgps com 4873427 N4H dgdgta com 46062271 wQZ
bzq 84 109 128 125 red bezeqint net 50566810 ZcB
arcadiamediaandadvertising_ education losca com 43258343 Z23 23 29 3 176 netptc net 35986000 9BS
gwalchmei com 76501891 u67
pvifilm com 51096328 h9R valmig2 skyrock com 54416653 Oo8
primalflow com 83252120 vFs
01k2r xmyzb com 49789225 aKu p54b3c18d dip0 t ipconnect de 52733866 HHu
usa searchonly com 29848833 BpA
mx3 sms to hollywood com 68938823 FDA daelys com 13035702 Ex3
santiplana files wordpress com 68493250 QPW
onlinebalaton tumblr com 91665150 38s benjamincarey com 17408245 RIa
18yearsold 0000074960 nakednaughty com 93719686 UNO
416934 sanjianglive com 77693956 fZx xdsl 87 78 120 19 nc de 86141087 WbD
lojadonatal com 75717455 l5R
sverko net 13471366 L1I wisersteps com 95214329 ALj
69pqp tumblr com 4220476 tcm
s8aan com 58986365 owf b160 net 62895720 0KB
safeteye com 20365928 Yo1
mail artispor com 091670637 t4A passwordselfservice com 010571983 bTD
61 223 183 126 dynamic ip hinet net 059621152 n9Y
praxis muendel de 030703717 VXC loveawesome6868 tumblr com 063929834 Ye9
wechseln kfz versicherung de 087246243 xEf
wd silikon de 028035583 JmB sassythought tumblr com 060997079 OJH
poetamalungo blogspot com 029263221 6d6
ns1 hospedajedesitios com 39272254 euq dave b4tista skyrock com 2380207 W9t
gxtauto com 58009793 fjv
67 41 180 221 slkc qwest net 31881681 iqc kenlyn net 67678785 Ekk
35 red 81 39 151 dynamicip rima tde net 59724840 VPm
nannvsanku sssrrr com 33604478 AW0 dedi2757 your server de 27897062 Q7b
zinnziegel de 46126617 neM
hopelesslyydevotedd0 tumblr com 91668188 t1C design maitschke de 9600484 ABx
adsl 66 122 210 228 dsl sntc01 pacbell net 10347281 5q4
olhardebeleza blogspot com 50306044 z7u marketplace winnipegfreepress com 78252243 dcP
ec2 52 39 139 97 us west 2 compute amazonaws com 70016566 gW3
pool 70 105 190 178 alt east verizon net 36430757 OpE mail dynamitelaserbeam com 19331949 1GV
p548aa1ea dip0 t ipconnect de 94868733 6jx
71 34 176 53 desm qwest net 71135984 LHx unterbruecken blogspot com 18231898 0B1
static 108 7 12 49 clients your server de 28754454 2P9
agingchildren com 94215053 JAv spicmacaypantnagar blogspot com 29213604 0Vt
jadeagnes tripod com 74439352 Ywz
gpa2blog62 skyrock com 90638237 o70 testogendirect com 31543030 eTb
adsl 99 155 73 168 dsl bcvloh sbcglobal net 95266881 eQQ
forumalmeida blogspot com 080283487 JGN andreluizfotografia com 096063876 xiz
81 235 205 93 no59 tbcn telia com 054246099 6TG
74 red 79 150 189 dynamicip rima tde net 035672510 Ytt cpe 76 188 218 226 neo res rr com 050483597 t9p
pool 74 109 200 193 pitbpa fios verizon net 012129608 Hlx
p5ddaaf88 dip0 t ipconnect de 063876661 Zej elafirdasiskapendidikanmasyarakat blogspot com 09181586 fsk
u8i myhotaltima com 06613027 N6E
cylak jxxgn888 com 24328030 FyE blumenschemel de 54062766 60f
maxis360 com 7361294 JzF
lobeda com 82956022 E6O sybilization tumblr com 51158968 2pC
engrjobs com 70552928 ftI
foljaumeprimer blogspot com 84413672 R5V pool 68 238 121 253 atl dsl w verizon net 85782556 ymZ
rrcs 70 62 151 206 central biz rr com 38674334 f4O
redbussecondarydns gettingoffshore com 48622280 dAo pysselbacken blogspot com 86835983 9fv
bl0ndief0rlife tumblr com 11190889 DJO
ip68 2 29 190 ph ph cox net 87077493 jKK pc 198 78 239 201 cm vtr net 74634406 uTR
fitce net 86232423 ues
sofiane lesite com 48153404 Utt biosoap com 19639566 F6o
krogulec de 42574683 xwo
h133 145 213 151 dynamic ip windstream net 60210630 wDf beepeople tumblr com 93897594 jeQ
nudieco tumblr com 14986320 a0e
lns bzn 47f 62 147 137 184 adsl proxad net 39681820 tlF ws esr2 208 102 113 15 fuse net 32208182 S1S
cpc113498 wiga15 2 0 cust607 18 3 cable virginm net 88368788 k1f
halifaxinternational com 89114095 yjP c 98 229 75 53 hsd1 ma comcast net 12805893 pkH
218 173 132 191 dynamic hinet net 63298283 KDG
mx0 maroc voyages com 034473538 wH7 misskurtzgrade5 blogspot com 082021732 s5i
75 172 6 165 tukw qwest net 023348374 O1u
fl 71 49 14 111 dhcp embarqhsd net 065055367 Un8 lazycollectorsworld tumblr com 064470749 MTr
yogurtyourway com 095423860 z2F
c 24 60 161 51 hsd1 nh comcast net 048508407 py4 silaence com 098997657 TOj
ludographie57 wixsite com 029862215 Sar
gongyelingqijiguilingque vvvqqq com 84728801 a6S comutecentre proboards com 32209654 m0a
69 46 227 103 lightower net 57186187 5U2
bcafe2 mie1 net 91426893 xzt aenigmaservices com 65051494 O1I
kevinbwatson tumblr com 2249853 YHo
adsl 66 141 179 52 dsl rcsntx swbell net 95987734 eKa infamous bitch tumblr com 27800546 elT
johnny katharsis de 24327421 ABn
v1207 ncsrv de 51400068 0Od c 174 62 215 82 hsd1 vt comcast net 13640470 2z7
jacman1 tripod com 66386010 SSp
so moi 64 skyrock com 89983337 g1T h37 111 117 75 dynamic ip windstream net 59579458 7fe
orthopaede neumeier de 76107598 f9L
pool 96 248 215 178 nrflva fios verizon net 36748978 6t0 235 sub 75 205 91 myvzw com 25786505 ZfP
rxgcorp com 50200107 f4Y
c 107 3 36 210 hsd1 ct comcast net 87473065 qGk bartos galabau de 11647370 1ZU
dslb 094 216 166 193 094 216 pools vodafone ip de 97167652 Sbm
l0ok japan r0ck skyrock com 18056539 t4y ppp 70 224 192 84 dsl applwi ameritech net 40560767 BNv
phpjavascript com 77181816 Uwl
152 red 79 152 247 dynamicip rima tde net 37049154 ZRp weidenbrueck de 16032056 e64
seglobal com 77586424 duH
ventdrivergalletti blogspot com 063786764 0Ud newvintagebykriss com 021801737 54I
store swivel net 097561039 OSW
alexandrasyk deactivated2017042 tumblr com 05177314 jQr cntzgx com 088404620 0qX
iman246 blogfa com 031269154 qJu
mall jmgnxx com 052301466 Ock a23 0 207 64 deploy static akamaitechnologies com 017783455 HhW
ecommercebulgaria com 031494331 11D
p4fcb9f0e dip0 t ipconnect de 7360328 0GQ taurusj slides com 7523031 FN9
c 76 24 247 143 hsd1 ma comcast net 70668925 9JL
p54972852 dip0 t ipconnect de 90330734 u3q gyn onko praxis com 70694946 txh
astrologerparshant files wordpress com 88213654 zLz
girlscoutalumnaeassociation com 28853198 2HE heinz wagner gmbh de 12994551 kIn
host86 131 231 215 range86 131 btcentralplus com 90081683 NCP
ceis real com 32359978 HFO jawaher009 skyrock com 48675095 com
transformationfellowship com 95401953 zdu
duogongnengbolidaoshouyaozuan vvvqqq com 81880679 qRX mail sonicbloom net 29671772 mu9
h3pyj sanjianglive com 28218035 Eig
princessgreeneye blogspot de 8440917 PIO tutorbright com 49441182 TxZ
75 163 192 177 clsp qwest net 41050719 0Lq
host 091 097 114 221 ewe ip backbone de 47107644 M7N p57a2b940 dip0 t ipconnect de 65991720 Aex
brownnewstrackcnn files wordpress com 94628420 qpO
cpc105480 brad21 2 0 cust89 17 1 cable virginm net 61534567 TLw 71 153 246 91 lightspeed hstntx sbcglobal net 47440227 YMu
dslb 178 002 097 067 178 002 pools vodafone ip de 92066967 a5n
mail dabbak de 3695945 MV9 suppliers mazdausa com http l2 l1 l0 nyucd net 41130556 qCV
onehope oneclass blogspot com 84294584 ciH
futurology net 065133853 wNs undervictori tumblr com 095687749 wS5
academytuitions net 086180337 baB
germanpokerclub de 088332298 fxY mx0 bucher bienenkorb de 013351940 Y9R
godaddydomainnameauctions com 043945896 2xO
ailsean net 010870299 tim vs155089 vserver de 04038747 Vs4
handymanserviceblog handypro com 032718872 Yiw
inngbizz tumblr com 55601879 FFd polytrade free de 47779619 2iy
072 181 204 144 res spectrum com 90199195 44n
sdfyy com 6070848 rSu s8lw3 onouta com 50256690 qW2
ppp 71 138 249 207 dsl sndg02 pacbell net 3585438 m38
221 red 88 18 45 staticip rima tde net 32005569 xIN c 68 48 117 254 hsd1 mi comcast net 69535831 OTV
heyheyheather onsugar com 32944710 GYU
montllobermudez vivencies blogspot com 62961062 MNP mx0 aboudeif de 58399611 i8n
adsl 76 195 234 27 dsl wlfrct sbcglobal net 85804816 uR4
edv rott de 9110561 Unu dhxsms com 97216028 KeJ
christoph bianka de 50445910 bab
pool 71 243 195 207 lax dsl w verizon net 50927209 SbR fussballsonthofen de 97095358 KhL
limestonemetal com 34271799 f5A
public strategies net 27526461 ibo posetiivari net 94129638 9hC
daikezheshoubingquanfushoulun vvvqqq com 13718043 kXO
gohho net 36747389 8zM ieqparquedosanjos blogspot com 91841586 LRH
li1641 94 members linode com 75807133 abq
mx01 yasammedikal net 93738505 xNs 75 168 34 249 mpls qwest net 34271190 FQU
all on four de 44908676 wkF
mail1 ssf nuernberg de 031749804 GQT p5b2eee45 dip0 t ipconnect de 087278084 3Pw
globalservices de 092452896 DjV
lincaorantu sssrrr com 038857897 b9F small business credit com 04054561 e50
u56ej sanjianglive com 09931408 Anj
leverkusen net de 069733853 F9w mail ichizawacho container com 052739793 eTh
51 red 83 37 111 dynamicip rima tde net 031255098 R5j



caymanislandslotto com 95943471 XT0 precipitacaoacumulada blogspot com 80597713 RsE
huagongyuanliaoshiyoushuzhi vvvqqq com 1302366 tLs
gaypprnstudios gaystudlymales com 56763977 nwP stocksfoundation com 10579206 sNL
71 208 77 153 ftmy qwest net 65564635 Nhj
217 red 83 60 241 dynamicip rima tde net 18000075 bcm middtrade com 69817543 h5U
mail habboday de 60358533 Zp1



projetobetaniamairi blogspot com 48644458 cDY waag de 2231141 5zU
mein baupartner de 87535311 zg2
210 210 63 203 lan sify net 87319508 XRh pd9e8c8f2 dip0 t ipconnect de 91509414 S8y
govem com 80361137 bRk
cheatyourwaythinprogram net 70192210 Iwd 70 57 62 232 hlrn qwest net 6119855 mYp
vkweb de 42032118 mtJ



priyablr123 tumblr com 62644222 rsn inamewelt de 54090460 6xA
server88 208 218 27 live servers net 99775613 ndE
adsl 69 227 128 227 dsl snlo01 pacbell net 96364665 wuh mail kredite 1 de 4486127 frs
p5b2922f9 dip0 t ipconnect de 6877058 UY3
tikva com p40 spamhero net 92397724 HtH inspection generale com 8592499 LTJ
dyndsl 085 008 098 143 ewe ip backbone de 72573197 D0E

tsfzc com 65675630 jB1 karan casey musicload de 98060494 NWA
71 220 31 108 mpls qwest net 73802944 Ww2

pemenangbola net 22941196 YhA lacomidayyo blogspot com 89938785 bQi
baiyepianwanggaiwanggai vvvqqq com 51741164 y8K


dejiha blogspot com 60366641 Hm9 206 193 239 124 nauticom net 70215130 ilF
mail vinsome com 37674666 n5H
comamazon com 81245725 4tf p57b32a0e dip0 t ipconnect de 60401580 ztR
ariellovesgot7 tumblr com 33728393 UIY
johnpatrickconnors com 81236198 F0J ppp 70 226 210 224 dsl spfdil ameritech net 62301004 5Id
energyseer com 76303654 0Tq
mongoose tv mail protection outlook com 58604319 dkv pool 100 7 26 226 rcmdva fios verizon net 48266665 dBl
neonstop com 29283933 YdV
x5f763c3e dyn telefonica de 88875571 Atc kampa finanzkonzepte de 11808496 Rmf
75 143 116 77 dhcp aubn al charter com 15512699 H75
ip68 4 81 226 oc oc cox net 54459866 eXX static 76 160 53 130 dsl cavtel net 10829574 eix
instantcollectionthingme tumblr com 57358213 Rn8
pukko homeserver com 4384546 S2T usedomurlauber de 66831074 Tkx
239 sub 166 239 163 myvzw com 77485127 OEE
sancia lodge maldives hotelsresorts com 80654045 3Zj static 65 53 7 89 ipcom comunitel net 56322855 WOQ
piccoletazze blogspot com 32534649 HBH
gerhard lange antiquitaeten de 45402720 pgb 39 qarestr sub 166 180 248 myvzw com 39770078 57g
21 red 79 148 20 dynamicip rima tde net 86360193 5CQ
c 76 117 60 156 hsd1 nj comcast net 015640066 l24 143 sub 75 206 44 myvzw com 065262892 1im
66173 sanjianglive com 030683909 vmY
d198 166 35 162 abhsia telus net 011813279 2of ip 107 180 24 103 ip secureserver net 060194041 CI1
haakis de 012762393 XDh
toskanababy de 079518807 RSO hnjg0371 com 034889174 MTU
visitgzira com 032781781 Dtn
67 red 217 125 20 staticip rima tde net 50785140 xDL mtwg wtag de 34383228 gbG
marveee96 tumblr com 39124054 7Qp
gwdins com 87123225 Yye electricbluejeangenie tumblr com 17096368 7sl
pc 218 208 86 200 cm vtr net 40875110 GOu
thegiftedone com 46733406 JSG cpc145838 warw19 2 0 cust87 3 2 cable virginm net 72200534 ggp
kuehlfrachten de 92134065 GlX
in c o m p l e t o tumblr com 76369028 dAu charline92700 skyrock com 4167153 IGr
l countries l tumblr com 89644810 6N7
p4fd40e4b dip0 t ipconnect de 64456194 AQ2 jlazkano net 95101224 uLv
static 65 18 202 116 clients your server de 90666715 rCK
etedgi com 29805399 eJr intothescentedgarden com 94076710 g1X
lipinpukewaimaopuke vvvqqq com 15322378 Aa2
whitelilyrecords bandcamp com 41922782 qdQ 168 80 148 77 rev sfr net 27054575 LTe
stopagc files wordpress com 15192153 dVN
softbank060122042074 bbtec net 29688444 nZL rixupixu tumblr com 77445880 EvT
c 69 248 234 59 hsd1 nj comcast net 74690699 Z5w
n l p com 75684474 xBU rawveganbrasov blogspot de 90747617 cNE
electronicsmarketing com 49044886 YsB
220 131 67 46 dynamic ip hinet net 038837195 TLd dslb 178 002 194 213 178 002 pools vodafone ip de 019903287 YKi
ticketsbolivia wordpress com 052411114 IsT
wealthactive net 015351155 cYd camlicakitap de 096670541 2uz
staplerfuehrerschein de 079887648 Bhq
ljorb sanjianglive com 036445525 Hco dotq6 kllbg com 089191064 Ie3
adsl 71 158 169 240 dsl rcsntx sbcglobal net 082779855 A5l
oceansidegarageguys com 84484772 Oa7 khutbah bahasa jawa blogspot com 77192694 crk
lepertique com mail protection outlook com 39748383 2Vb
1rip aqb891 com 54078314 STc microcents com 53026722 e9W
xx generati0n xx skyrock com 8834115 f63
8b8fb820 dar benabdallah com 22923277 ZX5 892 ut06 com 786331 SV7
www3 flk1 host h net 19423880 JNK
128 red 79 145 118 dynamicip rima tde net 35992433 hYU el libro de la esperanza blogspot com 75426873 fIc
narengue blogspot com 6172492 jGz
caroladipoi com 51662999 Voz amadeus accenture com 1452480 RMz
weinbar wangen de 14284506 DGj
ecadial de 11604658 MjX c 76 113 70 217 hsd1 nm comcast net 74320328 0uD
maudru com 11783403 uPC
a184 87 51 2 deploy static akamaitechnologies com 32508055 29E h87 119 20 98 dynamic ip windstream net 98009707 jwz
zelacom com inbound15 mxlogic net 76139680 Kx4
190 72 200 54 dyn dsl cantv net 39644502 PMU atelier richet com 60164506 4qC
bsg bluewings de 74191458 hvz
pool 70 109 19 210 atl dsl w verizon net 85977938 ALI time assistant com 1781865 FCX
bebelere com 36406657 RJb
kinkitv com 066245099 Rii dc 5a10d1ba88f3 vectoropenstock com 091241142 jpc
weathermansshelties com 081152090 UyL
go springest de 025620303 02X late night music de 026558879 7X0
raherc net 058158524 q9X
cndnorhed01 pool0 a99 cndnor tds net 010456799 4FG cuttingedgeventures com 063910530 Sw9
148 red 79 147 118 dynamicip rima tde net 04910101 V8I
c 76 110 67 199 hsd1 fl comcast net 85147433 g2m kalbfleischhandel de 85395214 x1j
sajibooty tumblr com 19077945 UQU
konstanzelaeufer de 13617604 7yP 175 63 112 92 pool ukrtel net 67084853 rEG
ypr1q sanjianglive com 80773379 hJL
luluartstore files wordpress com 88939977 kVu shengwupinpunengliangwu vvvqqq com 45352236 A40
p54a63ab7 dip0 t ipconnect de 6007243 4v1
the kingsmen knights tumblr com 44716473 jPW softbank060138141152 bbtec net 29501630 bq4
jvlviaa tumblr com 1014857 xG4
node k85 pool 1 2 dynamic totinternet net 32421675 3Ts huntmoose com 12672977 l7y
texasresacablues com 46887589 uHE
pool 108 5 177 25 nwrknj fios verizon net 33869622 bbl sims1 blogfa com 48362913 sga
ns1 gold feed com 51716198 O5E
wsip 24 248 97 125 oc oc cox net 1958657 KJl trizoniahouse de 24757198 5DE
068 184 150 230 res spectrum com 63739281 329
p5790ebdb dip0 t ipconnect de 87686963 J1Z laguiole besteck de 79958189 x8q
ghostlyrodent tumblr com 91437142 GEF
mojeserceee tumblr com 43417935 Vd8 avantgarde cosmetic de 75891951 xMl
netdosis de 74654263 cXW
livhairandbeauty com 066581353 3Dl 97 126 86 50 tukw qwest net 037230418 GkU
caseiros blogspot com 092167941 It2
c 73 208 182 20 hsd1 il comcast net 064101075 xro my kretschmer de 02861843 lsX
hankewych de 059793913 ANN
88gy net 0533466 SQx mpbrown net 027284844 wTI
webfisherdesign com 057894822 oP0
wwwmina now appspot com 76244793 YWt antoniominino blogspot com 52578031 Xsz
marcosflores com 8477776 WoR
mcindianspiritbelgium net 86214621 Nke cpc109821 linc13 2 0 cust681 12 1 cable virginm net 60809626 8vJ
christian b aho de 56598941 lE6
bzq 84 109 182 108 red bezeqint net 9041730 MqU cpc112443 pres20 2 0 cust936 18 3 cable virginm net 22367368 wbu
abrahamlincon1 tumblr com 69362187 DuH
internet marketing strategie de 79710869 SbZ mansfieldhomesforsale com 16497618 Tig
host vendeit com 46831614 Qeu
develop chaolongwang com 60867002 0iJ mx1 travelfaire com 88491790 SlS
ellaglasgow com 55236100 VjN
quebuenaorlando com 32945483 Eq2 d2dgolf com 59928510 a2n
theninetieskid tumblr com 10026244 ayl
ifreetxt com 38200098 gce hdjxzz com 70186478 8kB
27 red 80 38 113 staticip rima tde net 40896855 r7T
dwdigital dwdigital com 41150090 pWX wurstschwein de 97831504 E3f
c 71 59 92 221 hsd1 nj comcast net 28681226 DQb
ugeuge net 78079640 LCM xbhiz kianimpex com 16599551 tC5
92 red 83 32 134 dynamicip rima tde net 65328180 kAB
adsl 69 106 235 16 dsl pltn13 pacbell net 08723688 Asf evatempelman com 017375998 xQn
forevernumbforevercold tumblr com 068439479 63w
c 67 161 45 113 hsd1 ca comcast net 083805300 UhX ip 80 226 133 19 vodafone net de 034254151 ZMM
125 225 97 89 dynamic ip hinet net 011027290 7VN
giftdubai com 077609824 Dty a89 182 193 44 net htp de 023063017 A95
adsl 70 130 153 47 dsl stlsmo swbell net 05911889 Qhn
getengati blogspot com 26946261 nmx officegarden net 13146774 K3X
200 red 83 41 144 dynamicip rima tde net 73095505 4TE
0x3ec61a83 ose customer dk telia net 90335859 vxV pool 108 51 167 123 washdc fios verizon net 57812138 r6Z
its me katlyn dont be hatin tumblr com 12811066 SrI
tensaoutdoor com 28651769 au2 pool 72 94 73 3 phlapa east verizon net 28061511 u1y
beerbuddies blogspot com 69954412 ugg
rrcs 184 74 147 225 nys biz rr com 21163256 ICn thechickmagnets blogspot com 98105452 ocF
ur garten de 87503320 MXe
ww17 cageoffroad com 91796490 al9 209 112 223 31 rb1 sol dsl dynamic acsalaska net 96891924 ZTo
c 68 52 26 212 hsd1 tn comcast net 56163279 l5e
489765 sanjianglive com 46578726 4GN mail eltav de 72541798 4el
cienporcientofeeling blogspot com 83052936 958
d154 5 48 80 bchsia telus net 47550716 zmY titelooo83 skyrock com 5865594 IaW
nofootistoosmall com 53758725 E6m
lauriesphotography net 36776720 g5F mail fogyou de 92888437 WTZ
x5f72576d dyn telefonica de 21341346 oPH
pool 71 169 122 103 altnpa east verizon net 44953711 Ts7 fangirllevelover9000 tumblr com 93059567 1Ig
hotholes360 tumblr com 31732951 sbI
homecaremedicalok com 053634651 jED 7zp2h sanjianglive com 014532823 OqG
pd9e20d4f dip0 t ipconnect de 050004758 S2Q
flexptny com 091953191 XPv smtp124 outsix de 029813738 G8y
tecenferejav blogspot com 0715656 ov9
tbjjbihbhcbb turbo smtp net 016227889 KnK dazedandamused net 065952354 gsv
david shine com 038279842 aRt
190 sub 166 143 131 myvzw com 77898640 nM0 p57a5128c dip0 t ipconnect de 46193274 kpz
dogcatcherboy proboards com 91185496 KRe
pool 96 233 210 34 nrflva east verizon net 38448616 M71 waterfallnobranch tumblr com 74544366 Kxm
c 98 193 220 150 hsd1 tn comcast net 44759833 iQ7
cpe 70 93 240 138 natsow res rr com 59179812 ssL herrmann schrott de 84683451 iHo
bhma sammlermessen de 23881080 ujp
p4ffadffa dip0 t ipconnect de 4054986 Di1 wristfashion com 66062101 Ixm
zaysa net 74842946 RoH
virtualhospitaltour com 9467875 mJ6 immortalkuro tumblr com 76181999 iQ1
funtimesunshine com 91564456 hlA
ashiy com 15881442 TFl estanleyyostart com 79493975 Lot
bibimocq blogspot com 84499854 JCE
beccafarris com 49456822 xqt c 73 179 107 28 hsd1 fl comcast net 31352659 w8Q
71 214 163 80 tcso qwest net 64368302 8g0
248 red 83 50 80 dynamicip rima tde net 68678930 WpE packslimpatch com 71626461 6To
adsl 68 123 193 78 dsl irvnca pacbell net 94765621 1NO
diaries of a fitblr deactivated tumblr com 13352216 NlE monthlypetmeds net 59671883 OKj
75 171 110 136 phnx qwest net 96210897 uwa
c 73 68 45 116 hsd1 vt comcast net 025687254 5vd ibericosvallehermoso com mail protection outlook com 018727064 g5D
jackwolfskin legerosuperfit christophe de 094888767 P3H
pd9eba003 dip0 t ipconnect de 031088593 PoA foggyloverjudgesludge tumblr com 055570453 8Ed
thenakediaries com 016177078 r3t
vanderstel group mail protection outlook com 056935153 0FO emtasasindirici com 011336818 hYX
snu rlp de 03269229 kS9
p57b938cf dip0 t ipconnect de 30295304 WOR 74 34 148 39 dr01 blfd wv frontiernet net 60564728 SVq
mail itsoluzioniglobali com 59647924 pmV
ae6rp7 egt688 com 34396187 0VH sailsation net 44905426 Jhy
dailyvitaminb com 67549103 ytM
chalkhillcom com 19221565 dBH static 131 93 9 176 clients your server de 483826 cji
p5b111286 dip0 t ipconnect de 47317197 Ry4
p5dd5dd63 dip0 t ipconnect de 61957534 UKY 323pf pylincoln com 22110251 Bvj
mycorporationregister com 29223493 BUr
77 108 61 153 static bbbell com 30400785 paK adsl 76 242 21 126 dsl irvnca sbcglobal net 31586199 xOQ
static 30 66 224 77 ipcom comunitel net 50326901 vza
64 1 79 178 ptr us xo net 62287235 IRS ich group com 65931525 1l7
cpe 23 242 149 183 socal res rr com 81597529 GZ9
114 40 155 96 dynamic hinet net 50185024 9Pc bonniemclaughlin tumblr com 97032829 yQM
bikinilingeriestuff blog tumblr com 73258338 pjp
114 40 49 158 dynamic ip hinet net 61874158 M2t eden alpakas de 38939399 C8C
sheiber com 90386537 Gxw
outervoid com 68931716 zHs evertime0 blogspot com 28368861 PKY
winners espagne skyrock com 73127413 ymd
blesel metallbau de 05625543 Dbd en van de riet makelaars makelaarstarieven com 099519001 8r6
stempelkaufen de 066203778 zOR
h4ms com 011455385 WAi va 76 4 68 151 dhcp embarqhsd net 08359399 q9P
host 2 102 220 238 as13285 net 088983093 lDW
flowersbakerysucks com 019874055 N7c gamma service de 025483697 ylf
studioleila beautyandmind de 017131331 fds
chamsysusa com 32214394 6hl
jennifer klaus de 73922941 0Dr
144 sub 70 210 136 myvzw com 54823342 kXy
takewingalaska com 83639927 fDy
ec2 52 4 58 231 compute 1 amazonaws com 77845220 bZz
ppp 70 251 81 8 dsl rcsntx swbell net 5395222 HWa
waitingforahollis tumblr com 89632986 Jjo
p5497ae26 dip0 t ipconnect de 78841370 uPN
deejaydonniedon fourfour com 27611089 n33
mobile notary com 78242140 Ygs
residehere net 23746234 qkR
johalimedical com 62843970 ZJD
pool 108 45 65 108 washdc fios verizon net 96799408 l0t
cruisinweb com 6787556 55Q
lauterfilz de 10788563 lUT
mx1 herunter de 2772213 rSW
jnlove com 31887149 jyl
electracord com 27621548 Wea
fourseasons dekoration de 413317 6WL
ladydahlia com 32449755 KKp
hahn net 24879833 yBQ
jukiedis createblog com 25236483 O1x
couponnab com 22309326 9p3
kik33709 tumblr com 18341692 6ho
hacker evolution baixarjogos com 62358023 BFS
1 sub 75 211 110 myvzw com 627691 KSD
219 red 176 84 243 dynamicip rima tde net 6342156 8UI
114 46 217 53 dynamic ip hinet net 76178996 qG1
ool 4356843d dyn optonline net 6640022 NHF
c 24 8 21 181 hsd1 co comcast net 43608988 LZg
fl 71 3 67 21 dyn embarqhsd net 35914175 ie0
aenniesmachwerk blogspot de 62547455 OCD
s0106105611bd247c vc shawcable net 54757876 l1U
c 73 185 203 24 hsd1 mo comcast net 80348851 ID4
mail yoratchada com 37672726 quP
lns bzn 30 82 253 176 101 adsl proxad net 41199974 tqE
blog douglas shoback com 23537395 bkl
birgittaschrader de 93313396 CDM
clean v4 1 1135 398705 crack locator com 30526282 qvE
jleardi tumblr com 74792674 7oT
solvayplastics com 18860563 216
h184 11 55 139 dynamic ip windstream net 81386198 acs
mail hunte macht de 50336717 lkp
atouhou net 22438399 Dqj
itskaaaay tumblr com 97307209 WEV
dslb 002 206 229 139 002 206 pools vodafone ip de 30113096 w8u d205 250 191 70 bchsia telus net 73191751 4hx
jaska minshky tumblr com 96405109 W2h
craftshop net 82900766 0zy k arts net 9020057 Uea
gigantes net 21204186 NUU
jsu bird hannb 02 mssp bellaliant net 48016909 u02 48 red 83 58 127 dynamicip rima tde net 97185000 iEJ
poolfence net 4163251 SjJ
strategicspacedesign com 92524912 J17 c 67 166 27 187 hsd1 co comcast net 90274598 rrG
softbank126103159043 bbtec net 7287733 1MB
mail teknapress com 29205076 Qfo lucidfactor com 72770197 yHc
a104 107 7 82 deploy static akamaitechnologies com 93306341 b4n
flexicare com 80588883 oEc ohh yay livejournal com 87912614 8YO
gaoguangmuhe sssrrr com 27560466 UXv
mail sonichealthcareusa com 88324020 Meh 107 182 25 186 16clouds com 4642504 f9d
bankofil com 84410450 6cs
shirtmasters com 1916225 3Gk 190 37 29 104 dyn dsl cantv net 26558256 qA3
linux emlakkulisi com 69968720 2g7
dslb 084 058 118 213 084 058 pools vodafone ip de 28992791 jPr cpe 104 162 162 111 nyc res rr com 19528351 xDu
words that start with poly worddetector com 39356639 tu9
dslb 188 106 170 020 188 106 pools vodafone ip de 054533277 oFi frederickbridal com 053444308 jw9
cpc145506 basl14 2 0 cust197 20 1 cable virginm net 019342995 VLb
helifrog com 048257202 ktl a89 182 203 111 net htp de 033179561 7FX
115 7 225 89 dsl completel net 017480869 JpL
77 sub 75 196 66 myvzw com 048233545 4jg ww38 apparelcycle com 085517357 11S
luminorsolutions com 042408257 zmD
45 red 83 55 244 dynamicip rima tde net 50148040 Km0 fendermustangstory com 83998557 8lV
tennis sva de 28951525 n2G
loud is lover tumblr com 88231740 vqh neubauwohnungen kaltenkirchen de 78980685 Vk5
cpe 72 129 133 122 new res rr com 56401601 ayY
recomendo ler blogspot com 34398078 7Fz plugvalves 649552 free press release com 25752384 tZZ
c 75 72 230 142 hsd1 mn comcast net 40624800 LOe
iapostle com 32040061 k1r mybroadstream net 14779400 ets
109 200 255 216 pool breezein net 83173750 sJJ
cottonbowlbetting com 11882967 KJJ static 26 14 229 77 ipcom comunitel net 92737898 uj7
meetsj com 87800847 he6
crumefamily blogspot com 17810019 3tJ ip 88 152 117 220 hsi03 unitymediagroup de 83782735 kwT
p5b3db61a dip0 t ipconnect de 7597930 tc0
65 103 224 89 dsl completel net 70202278 RMU littlemissv livejournal com 32788708 gw0
progressiveageant com 18211624 O39
asus2 deutschemailbox de 83567372 p71 nyscollection de 20392855 SKz
pool 72 86 2 254 lyncva east verizon net 10837851 VkC
rigdown net 66995657 4rk patchworx net 86972335 3hs
cock0clock tumblr com 43596614 Zzd
floorplansapp wordpress com 025813297 KIt dooropen fc2web com 014333587 EFD
fernstudium grafikdesign de 088683349 XUC
bernardbrulelesondes blogspot com 050101183 nZV printercraft com 014398662 V7W
argent12 carrefourinternet com 016904475 jfz
splendorfilms com 09289902 sEM 98 125 32 178 dyn centurytel net 099365427 yTI
revethelabel co uk mail protection outlook com 032924403 DJq
anotherdoor net 17959231 mhV tomassen net 473049 HWK
poderebenintendi com 33651842 GXK
so what001 skyrock com 38703507 2op p548c2cdd dip0 t ipconnect de 2971512 KZQ
606425 com 37643841 DN9
y0mfi ekspedisilampung com 70802556 JWy cvkip com 18941418 Ql3
lio1728253 lnk telstra net 87997271 uCF
adsl 76 237 68 245 dsl covlil sbcglobal net 34497517 NtC c 71 236 181 144 hsd1 wa comcast net 35713023 8qU
adsl 074 229 212 082 sip jax bellsouth net 91536490 w4R
777slots cncwoodengraver com 61595333 S8s c 24 5 122 19 hsd1 ca comcast net 62304220 4M0
97 116 178 163 mpls qwest net 45438563 Omf
dubaijinxiangliandiaozhui vvvqqq com 33671371 7AS a104 89 144 181 deploy static akamaitechnologies com 14939380 2s3
109 red 81 46 22 staticip rima tde net 48389555 XEY
bursaotoshowfuari com 25468177 xul marauderettebooknerd tumblr com 53727440 ujU
5bu88 1 78 206 52 190 fbx proxad net 4749216 szx
24 red 83 52 131 dynamicip rima tde net 57294658 1tp sriganeshstationery com 38656505 Ww9
neng 1 167 142 116 99 dsl netins net 82000071 Pqb
adsl 69 224 115 7 dsl irvnca pacbell net 96644204 HEP sfnightclubs com 63935568 2n9
fmv de 17989422 P6C
mynotsordinarydays wordpress com 091994394 lwE dr reuner de 083516795 YlN
mail basic domain de 042833860 R2S
a104 105 39 82 deploy static akamaitechnologies com 034993289 4bY paulamonge tumblr com 085861990 KPw
adsl 69 235 35 137 dsl irvnca pacbell net 097497938 KIp
apo designs cpage de 061920591 HqM suu yujiasaguan com 05240132 x6q
oneskyworld com 026464224 skS
lns bzn 45 82 65 150 22 adsl proxad net 65091782 rr4 onlinembaprograms com s3 amazonaws com 54808157 DL0
x4d0cb531 dyn telefonica de 16584514 MjL
adsl 99 140 203 83 dsl chcgil sbcglobal net 1849441 fx5 c 68 42 206 89 hsd1 mi comcast net 47376905 q74
jdfencing files wordpress com 89175256 xWx
fgcu csm symplicity com 37136787 LpJ animestroll com 61117375 fxz
c 71 197 228 196 hsd1 wa comcast net 63842339 SXE
milenarock skyrock com 31822025 05W juttastoll de 99491789 YrD
ppp 70 225 139 179 dsl ipltin ameritech net 62619644 p7R
extaasy chok skyrock com 81620065 1ia klauking tumblr com 66727644 Z8S
pool 96 249 231 31 nrflva fios verizon net 73929960 a4t
nannieshawaii com 70300307 oQX mta 69 75 140 123 socal rr com 63147732 nxT
zghhzx net 55291437 Si8
dartteufel de 16397692 Sek dc 0088e71a81ae bdsm video tube net 8514275 ax5
apricot poodle tumblr com 90316989 zdb
wngr net 71183038 Jro csikospingvin tumblr com 82617590 WEF
p508d8d2d dip0 t ipconnect de 40710356 BiH
softbank060127147164 bbtec net 22781674 2rC h235 222 29 71 static ip windstream net 18540498 YwK
short stack stalkers blog tumblr com 25434770 dOm
tttllc net 02672198 qJt print imaging com 043737429 hEa
softbank060104095150 bbtec net 045796070 PV3
giantsinsider com 078967793 f6j p54a92212 dip0 t ipconnect de 030135042 TiB
touristny com 071298680 XUE
mail1 xn frnkischertag cfb de 057263186 Cr5 maliyah burfeind659 tumblr com 086043214 7eu
livinmas tumblr com 082703753 BXJ
c 98 233 152 185 hsd1 md comcast net 91041480 v3W shower valve com 9589324 tCN
c 68 38 236 169 hsd1 in comcast net 98250119 2xi
adsl 072 148 054 130 sip int bellsouth net 98265049 og6 adsl 76 252 78 139 dsl lgtpmi sbcglobal net 18541868 xoe
c 71 59 201 39 hsd1 wa comcast net 60110610 7gi
infospot24 de 9448744 OMI 2gu antzpantzdrivertraining com 70812472 ClI
34 red 83 49 5 dynamicip rima tde net 67224858 DVr
gqtailor com 73191088 3Id globalmobilityprofessional com 58505733 UJX
pool 71 169 194 186 herntx dsl w verizon net 51518702 2Kh
instabustechnik de 27174218 PXi pc 36 92 74 200 cm vtr net 61708246 8CS
c 69 141 105 133 hsd1 nj comcast net 37380273 GMZ
c 69 253 191 161 hsd1 pa comcast net 17185534 Izs pepinthekitchen com 19373868 6pS
g5yvx sanjianglive com 33701361 1rc
wigeoweb com 58512581 bY3 r197 gp sp online de 45919778 sLs
thelump proboards com 3605266 TxY
c 65 50 168 66 hs gigamonster net 58523680 zVS 71 221 66 151 klln qwest net 92928415 ef7
adsl 76 196 1 237 dsl rcsntx sbcglobal net 28359787 fnh
keridwynn vefblog net 81577602 UC5 morecihadkock tumblr com 23186279 jGv
orim chi589 com 71530231 wAh
70 red 88 19 11 staticip rima tde net 038138646 ONr pool 98 114 35 140 phlapa fios verizon net 079008295 r9S
kemmara com 021713197 kXC
surveys2 theidfactor com 040765781 I3G fortgreenenews com 094252176 W2b
c 76 101 84 134 hsd1 fl comcast net 033215649 P2A
h69 131 32 67 qncyfl dsl dynamic tds net 097175177 7JG 404grils com 084923991 x3Q
bluegeothermal com 040982073 qr6
fishbit com 43982574 Bmd adsl 69 234 151 108 dsl irvnca pacbell net 3021426 Q0D
lerevedetokyo blogspot com 3350459 1iP
ppp 69 228 15 1 dsl frs2ca pacbell net 49583225 8Wh 25 red 83 63 190 staticip rima tde net 17898809 tPn
odysseycharter com 73168665 OSh
dslb 088 068 120 224 088 068 pools vodafone ip de 11568549 fdx finenuts com 76511338 xvq
cpc109017 salf6 2 0 cust19 10 2 cable virginm net 83513850 upG
searchgainesvillelistings com 37190436 EEu c 98 197 128 143 hsd1 tx comcast net 24946420 Xts
pool 96 238 60 151 prvdri fios verizon net 16974382 hWv
home crance net 39470077 ruR pool 108 36 174 21 phlapa fios verizon net 54805686 QZL
clickontelevision com 56451627 Mu3
rominco com 77859097 cAF elitemineral net 27502872 AYw
ppp 71 128 114 218 dsl irvnca pacbell net 55321736 6b6
distantvfd net 6573778 YuH gebrauchte mit stern de 31283754 LOm
ifylzpe pxmining com 80510358 iEf
tumulta com 45741579 tDg berolina camping de 50567918 kXv
a23 50 93 20 deploy static akamaitechnologies com 72891599 wk3
brandonvidal com 21441032 QG4 diabloteam81 skyrock com 57995024 AhF
c 73 16 244 78 hsd1 ma comcast net 29634787 V6A
host 091 097 219 080 ewe ip backbone de 082931360 fyd americanheart com 062864596 HbU
c 76 126 200 181 hsd1 ca comcast net 040888396 WuW
sexmutt com 026321887 sjE zahnmedizin muehleninsel de 011817555 KEo
a104 124 47 7 deploy static akamaitechnologies com 048424633 xeg
adsl 65 68 182 112 dsl amrltx swbell net 013221036 tqT lorrainechristie com 051279994 pNA
c 71 56 153 5 hsd1 or comcast net 051258729 XJp
choiby com 6973628 X67 stephengould com 20201121 uWO
adsl 64 174 36 95 dsl snfc21 pacbell net 2171109 r86
start air com 89125788 vAq glasgowjsoc wordpress com 48974981 pRa
c 73 232 229 136 hsd1 tx comcast net 12139849 8en
mail momohan com 46761397 Dnd dslb 002 204 014 070 002 204 pools vodafone ip de 4066434 wCy
rollins720 newsvine com 70465107 MPB
fundacionmontessori com 48038687 mdG armoredautomobiles com 7041038 gJ5
newsconsultants com 19928432 TVU
nitz barney blogspot com 67584569 3CN gosusanclark com mf rp securembox com 78212886 MnE
61 red 81 35 80 dynamicip rima tde net 44778882 AZn
aktion tagwerk de 94225433 AK5 dicforall com 54619959 7lA
ubajara com 13545321 qBv
host 82 135 97 57 customer m online net 93545330 VxI getsellerscallingyou com 83212545 1Lf
p3nlhdb5034 14 02 shr prod phx3 secureserver net 66161718 nSB
5300 2 clr 64 71 100 98 clrdialup sktc net 70394612 5sy gatewayclc com 86878616 bfQ
ftvvc 3a2sk8 ycxjps com 67543481 R93
mintmuseum s3 amazonaws com 25825861 cKD p4fc2a58c dip0 t ipconnect de 30082391 N8L
mail jolisftp com 53699205 dox
run the world lesbians tumblr com 02617837 63t nuttea2a skyrock com 07583320 JR6
port76 mx10 sps mxfw net 061405283 BYm
76 red 88 4 239 dynamicip rima tde net 098358653 9X7 epicwrap com 057891086 aQL
hajsb net 079596022 Q9L
anna53006 skyrock com 029759647 gWt amedes praxis flensburg de 021269738 0h3
mail cms manufacturing com 069391083 HBU
adsl 69 108 138 188 dsl irvnca pacbell net 91432819 qxr stw rd de 84658412 77u
adsl 70 240 25 110 dsl ltrkar swbell net 2335156 a9d
naturalescapescozad com 35396249 8x1 teambsr com 71006856 LeO
tiote justine skyrock com 70935320 v3m
d75 155 178 142 bchsia telus net 42023952 3wZ conceptualsolutions com 71113359 cLd
dynamic 077 004 069 246 77 4 pool telefonica de 71732634 6cM
newspush net 72872637 NAD pool 71 244 203 125 bltmmd fios verizon net 85106042 VPF
dslb 094 223 252 040 094 223 pools vodafone ip de 98746417 LN4
ns2 wwwbidmail com 34653352 1l4 shariallen com 14574046 vsW
beardedlandfreakcloud tumblr com 14191059 Nug
speedrevista wordpress com 57454039 L0a easy mesure com 71836727 WNa
inovawell cc 100 com 86566956 81A
around beijingzhoumo com 85177994 gzj ppp 70 250 119 117 dsl hstntx swbell net 3533062 kQA
xdsl 87 78 248 37 nc de 35262763 J0y
iquotejaysdadslawcommercials tumblr com 67837792 yDr deliciouslandflapwombat tumblr com 72777589 Oy5
ptgold taislim com 27601140 m7B
become boxoun com 38754266 NsD sodai gomi net 74686684 Qgh
d75 157 24 138 bchsia telus net 58546794 QXW
server88 208 209 132 live servers net 043261713 9bp buildremodelrepair com 046625951 fbs
nisivocciafinancial net 038484239 ybW
artokora de 03369698 Eej srkr net 064853141 aiv
mail dalamanrafting net 09119621 WDP
pd950af1b dip0 t ipconnect de 037191561 Qab ip70 178 15 48 ks ks cox net 083737204 eoc
pantais com 098355298 s8U
adsl 66 122 107 162 dsl snfc21 pacbell net 91313804 ZHT nj 71 0 105 72 dhcp embarqhsd net 91813629 73N
awarenessnow net 90541144 aAx
loaninquiry als mtg com 7415935 baA cpe 45 46 132 167 buffalo res rr com 97178742 Yxx
82 red 88 24 171 staticip rima tde net 38061637 NyJ
106 red 83 51 152 dynamicip rima tde net 36519626 BPP dyndsl 085 016 216 191 ewe ip backbone de 88961755 iLy
whatisfitnessx blogspot com 69733152 OiZ
nikkara com 40512827 LEj beautywithbeenish blogspot com 27674670 xKl
almaperdidanosite blog tumblr com 72317627 LYJ
pool 71 242 81 154 phlapa east verizon net 29321025 bkl thaicartrick com 60714308 wpz
wm2006 brd de 89005507 TIX
orainewsnetwork blogspot com 59827076 uDZ dramaforever com 70934796 hJI
ip72 207 130 249 lv lv cox net 54846431 e1y
ns1 tmgns com 23032739 Fy3 censormusic com 55884500 MUq
forsoftskill blogspot com 74255873 pVE
pedagogosenpotencia blogspot com 61360205 8an c 98 217 3 202 hsd1 ma comcast net 13564690 MVE
deronlineladen de 5039647 g5m
xehopdongdulich com 49539035 wqE unijr com 47263642 fPn
1tuwn sanjianglive com 52479917 OvA
mclarkfinancial com 097909609 S7z 87 56 99 116 dynamic dk customer tdc net 097498904 Dtz
177 red 81 35 66 dynamicip rima tde net 067094070 z6B
achterplaetzchen de 079414633 51P eab9fbe9 qvvo com 010683417 bZi
wsbn net 018765173 xEO
storymacher de 011822068 kJs wiedemann de 062201902 Wgq
adartbydiane com 077116247 IGI
mail cloudbrix com 75449063 Oya ppp 70 253 239 111 dsl wacotx swbell net 83988615 guP
ti211044033j290 ge8 50 ti telenor net 32819865 lTd
thedriscollfamily blogspot com 97613496 uYZ pool 71 98 168 104 tampfl dsl w verizon net 12808130 XeO
c 76 114 31 8 hsd1 ca comcast net 4385679 cD4
muckbootcompany de 82424018 w8q node 1kh pool 125 24 dynamic totinternet net 21226510 Xb2
adsl 76 205 128 184 dsl frs2ca sbcglobal net 44985802 QcO
maisoccer denarionline com 46164483 mPU mail drugu de 72758846 e1x
tracomtelecom com 35273558 f4f
ichundmeinfreiburg de 636158 Uhr lvpediatricdentistry com 97141253 BeT
plaidfrogpress com 2436655 JDk
mo 71 1 126 130 dhcp embarqhsd net 92364121 6hN ifw kinder jugendtherapie de 56654780 TXs
alcadis de 14557669 ncP
h69 129 195 210 mdsnwi broadband dynamic tds net 3994714 jb5 220 139 59 130 dynamic hinet net 17644256 f2y
vertebral net 62099310 jyp
ariannealejandro blog tumblr com 47775576 6rV savernotaspender blogspot com 44762709 bgP
static 18 126 224 77 ipcom comunitel net 75359298 zou
urologe ruettenscheid essen de 21583270 Cky redrum carbonmade com 63625300 Q3f
store dcfurs com 32948701 HKv
mamoeru tumblr com 035595825 yNq 74 93 123 162 pennsylvania hfc comcastbusiness net 07896960 Ey7
75 162 29 147 desm qwest net 052365561 N6W
marcbooten de 025727330 sIJ almuhairi com 060901579 6Et
fixed 187 189 81 183 totalplay net 04599245 XXL
118 161 144 116 dynamic ip hinet net 016357701 U05 adsl 067 035 092 128 sip mia bellsouth net 049426437 jXv
79 77 106 177 dynamic dsl as9105 com 081490900 YjQ
knowyourscene simplecast com 63262754 QDu iamcertifiedweird tumblr com 7941903 MP3
dslb 002 204 144 169 002 204 pools vodafone ip de 16321641 gyW
hollabackgurl90 tumblr com 51265169 32J pph weebly com 9796619 KZn
sobikes com 78406960 kaT
tearofhappiness blogspot com 27222023 AuA hansonventures com 77190748 QMV
lns bzn 40 82 251 178 232 adsl proxad net 80708679 Jdx
218 red 88 24 25 staticip rima tde net 89548001 qGh apxq44 dsl pipex com 60276709 iAU
jjy9192 egloos com 18319366 aIf
xshine net 10552638 Qqe pusaka2u blogspot com 80921978 7b6
107 red 79 154 132 dynamicip rima tde net 18371900 Omh
adsl 68 127 169 210 dsl pltn13 pacbell net 44744009 j1K 170 215 197 107 dsl1 nor ny frontiernet net 11189688 5OC
xoo agenaiis oox skyrock com 52481777 DDe
smavronas tumblr com 44205473 6cS 71 218 153 210 hlrn qwest net 85751701 Ue0
adsl 99 155 215 231 dsl akrnoh sbcglobal net 95930439 0Wz
irriport de 98866670 MOP d1 95 84ae static theplanet com 80573183 unM
ra ads com 62403767 T3p
pool 71 241 153 48 nycmny fios verizon net 32256503 19V manganimez blogspot com 34992922 Pnw
184 158 246 99 dyn centurytel net 74525313 Mj5
themeaningoflife 18months tumblr com 054457035 Fn0 igorgogolev tumblr com 040034071 qGC
s01065c769522666c cg shawcable net 050515624 LqQ
buddysell com 024876114 cqB pool 96 238 45 47 prvdri fios verizon net 021730451 qjZ
brasiltecnologia com 029350674 syS
a104 81 245 128 deploy static akamaitechnologies com 01653050 NtA archery go bowarrow king fr softonic com 036573463 D8h
mail knowledgevisualisation net 014214924 BRc
stamieuniverse tumblr com 77337113 shl englishtranslators89 blogfa com 64530553 kro
199 red 80 24 216 staticip rima tde net 18626692 mo3
mta 76 81 239 151 socal rr com 13866770 uJk mext unicreditonline com 1500219 4po
137 red 88 24 124 staticip rima tde net 74430149 3tn
tierarztpraxis krebs de 78192065 IUG bzq 84 110 178 55 red bezeqint net 93614105 cf7
elektriktamirati com 14577538 A0Z
extraclub de 76027901 5EF lesmotsdalderika wordpress com 2522440 yds
217 215 162 127 no549 digitaltv telia com 818845 Hww
134 red 83 56 151 dynamicip rima tde net 98453326 2NL p57a75cb7 dip0 t ipconnect de 35955480 Sje
normshoes com 60860786 nTq
opentsps com 7035750 zUj thealleppeyhomestay com 32779698 S69
xxoverdoze skyrock com 45093826 LMT
32417 brunch lunch dinner de 4572987 6r0 50shadesofestella tumblr com 33300456 2VQ
c 24 12 129 50 hsd1 in comcast net 26251805 DA1
root gays online de 92979832 GiA w2 neumuenster de 99323261 tM3
ip 62 241 101 71 evc net 15296949 ahX
bieruhr de 70864940 XsI c 73 72 42 126 hsd1 il comcast net 79009071 rYq
smartific de 26216162 kfV
hendrixdesigngroup com 38711882 CiX 63 226 14 66 phnx qwest net 41661810 b19
airtravelticketing com 33382375 U4h
253 29 12 dyn e pool38 pool hargray net 23749530 hT2 titelfe18 skyrock com 31904219 5fK
072 188 067 046 res spectrum com 75994604 NMM
zolohouse com 94646021 LcS soloby com 1689969 uHc
cprnearme com 51222872 bUp
218 174 66 161 dynamic hinet net 62607473 q2u dotis de 69997079 RBb
c 73 125 167 80 hsd1 fl comcast net 76531268 nqK
tauchen harz de 15063094 0ZV dslb 188 097 021 086 188 097 pools vodafone ip de 18333043 0Wl
martinkleppe de 25526912 SCf
fastenex com 23172808 S9a lasgrandesorquestas vox com 19871098 mpp
southernenterprise com 47953616 Jc2
0512waiyu net 13735635 h3b itsvapidlove tumblr com 49750735 L4W
guancaiyeyachengxingji vvvqqq com 29559523 tyq
aixpertim com 26108397 zbR theluciddreammask com 61180135 8aj
nw esr1 72 49 198 99 fuse net 10426194 iMy
mohajan com 49379054 Yh8 berliner service de 55863622 m22
c 71 194 36 108 hsd1 il comcast net 19166614 HeV
adsl 211 78 178 201 tyon sparqnet net 076281907 P2h smhp8 topcarl com 096440152 95x
mail stalco de 024103836 mIe
9 red 95 120 42 dynamicip rima tde net 023955190 87o whomademe net 068220163 m02
arivirem com 056199752 YHZ
ostseewracktauchen de 092275367 xKd p5dda16ae dip0 t ipconnect de 064189328 CMq
creativewash com 034105604 Mt3
inbound protech automation com netsolmail net 59664331 MOZ 118 170 138 232 dynamic hinet net 29392247 ZPg
bjzzi com 58482705 bbK
o columbus bhphlist com 92910867 ULl 65 119 151 66 dia static qwest net 30815430 ELX
c 98 207 112 138 hsd1 ca comcast net 93118848 u1S
pasareldia com 73031835 C3n die schwarze armee de 41486716 aww
ubuybuy com 26402906 4ND
internetdunia com 90466156 V0c p5b3a16b2 dip0 t ipconnect de 42616663 p2Y
niin net 31954082 0GT
softbank060090017239 bbtec net 77369514 lKf huntersshopnsave com 99169784 qyP
srvm1001 trcom 122489 IEz
ool 457ea9c3 dyn optonline net 66636977 8je warnmarkierung moedel de 63738284 mVd
consolidateeducationalloan com 67727304 XzZ
mail zeilinger pferdesport de 93165207 Oeo c 73 57 113 169 hsd1 fl comcast net 98720651 2Hm
premiumprotection de 21076516 BFt
archersparadise de 24351507 lW4 bsskielann blogspot com 7398664 6hn
218 170 5 226 dynamic hinet net 40106713 vMv
c5bs com 85099564 avJ schmiede meister de 10353759 FCE
akkutrimmer de 56438994 pBX
host 92 16 247 88 as13285 net 075445874 Qql bk1ux kk823 com 063718896 VNy
c 69 143 213 219 hsd1 md comcast net 091692423 rqR
curedebt com 02312442 4nW hundredpercentdead tumblr com 092820826 VU7
mighokjbgfd blogspot com 060898586 Fm9
gordon doodlekit com 052248690 3Zu 75 120 23 156 dyn centurytel net 048383693 IVp
cpc88301 woki8 2 0 cust471 6 2 cable virginm net 01726889 lXg
bajosexto net 10583168 1Yp adsl 76 231 240 199 dsl wlfrct sbcglobal net 28900348 7It
pd9fa69b1 dip0 t ipconnect de 60245330 J7I
69 162 223 14 dynamic cdma acsalaska net 42785011 NXQ swc1 com 88538479 cWo
apoinsider de 30617328 AzC
rayennefrost de 30064849 Spa investmentfondsdirekt de 92247837 qDj
96 91 240 86 static hfc comcastbusiness net 39468567 Vu6
mail dictatenowmail com 87122130 7Vk brysonthinks blogspot com 12692453 3qk
ip67 88 182 67 z182 88 67 customer algx net 37770074 4IP
rbmackin wufoo com 18320895 J32 principalless means volia net 49334094 t9k
utkanezpasji blogspot com 15004771 Dr0
c 75 66 76 131 hsd1 la comcast net 72933236 4BE plugnplaytour com 40577900 oft
chanakyacorp earth orderbox dns com 22081905 6zt
corozco13 tumblr com 98102643 ip2 mail learningtoleadpgh com 51243024 zSL
p5b2e22a1 dip0 t ipconnect de 4409645 wgg
c 76 105 19 201 hsd1 ca comcast net 50392660 BlZ pd9e20eb0 dip0 t ipconnect de 51667885 dMH
p54bbf1d7 dip0 t ipconnect de 71362437 KQO
75 168 147 197 mpls qwest net 83906363 7Ay cpc1 linc13 2 0 cust6 12 1 cable virginm net 14225452 XhD
digital vs skyrock com 34990363 h9D
pusatjualanmeru blogspot com 025051998 SAG elucydate de 049001507 ZOC
receitasportugalblog blogspot com 058150870 eP2
122 118 42 134 dynamic hinet net 082431634 rME bingoballroom net 087887126 m54
209 234 216 187 netptc net 036970060 n3y
static 76 160 55 129 dsl cavtel net 035594291 hO3 jonerfamily blogspot com 058965937 ACm
68 20 20 26 lightspeed rcsntx sbcglobal net 085200005 9G1
adsl 69 155 8 187 dsl pnblar swbell net 23163217 aeX gulinint com 85197806 OVB
sainteadresse coeur2ville com 42848772 e8g
cpe 76 170 123 52 socal res rr com 85895740 X8m cpc147338 finc20 2 0 cust859 4 2 cable virginm net 37789093 wJD
newptcs hostoi com 24101889 FiS
stumpgrinderstree com 50004177 aab 61 230 54 150 dynamic ip hinet net 98297595 QSV
youraustintxrealtor com 10142903 YwI
florareadsbooks blogspot com 93726779 pfF troycasey com 53848000 Mnp
pool 96 231 45 144 washdc fios verizon net 90217404 eFP
opelmesa net 90255574 igh ip 178 201 223 8 hsi08 unitymediagroup de 51982545 UHZ
static 212 129 47 78 clients your server de 28651431 cY2
germanyvids com 42464653 tCw jlshmp com 79310014 8Mp
karolinelindmo files wordpress com 3269132 0jb
i577bf48c versanet de 46627749 p1k 3ctoy com 92419655 z4O
augenarzt busch de 83806222 hiq
jugend thw lauf de 2772093 Wid sargentpress webs com 2028463 4em
joketxt com 75629959 obD
220 139 220 228 dynamic ip hinet net 62874590 Zdm pool 108 56 73 33 washdc fios verizon net 86459534 4HY
ip 72 167 60 254 ip secureserver net 2712298 bO0
gxmzjwy com 096689248 is0 dslb 188 098 110 243 188 098 pools vodafone ip de 027433018 H4I
awakendevilsknight tumblr com 012997563 wtf
p4fd4289c dip0 t ipconnect de 07413205 oEr mail raretribe com 064822307 wjH
amg 90 blogfa com 059131264 Kxq
nolte moebel de 024473783 rjR scfdhb com 013642037 qt5
whitephd com 076631384 z0e
i53872892 versanet de 63860303 wKZ heartmeniall blog tumblr com 60873255 587
bnf chengguoshangcheng com 94899700 am1
100yrswomensday blogspot com 51963456 ly3 adsl 75 23 81 234 dsl peoril sbcglobal net 28496319 8Ni
90sromcom tumblr com 74152653 yDs
206 193 239 93 nauticom net 14993925 7aA 14 red 83 51 21 dynamicip rima tde net 85298261 1Tc
centralbuero de 94975502 YEY
228 216 dothan cable graceba net 19560010 Y8m p r d z com websiteoutlook com 97040058 79h
17 red 83 58 241 dynamicip rima tde net 11399368 kFd
perencanakeuanganjawatengah blogspot com 72857027 IP6 sporerarts tumblr com 67412992 OJl
sarinette282 skyrock com 57569123 HeY
cust10205 lava net 1253701 Rvh p5b3124c6 dip0 t ipconnect de 51016988 LHH
p57a2d780 dip0 t ipconnect de 33574592 UOM
socalsonus com inbound15 mxlogicmx net 90817026 ztl roraimagroup com 47781014 eos
elymus de 85254935 bkJ
ephebovibez tumblr com 86498657 HL7 malawidreams de 53108859 6zd
65 73 135 164 dsl1 mon ny frontiernet net 42494453 UAM
kruisdijk com 69218358 BaO shop porsche com 2991583 lVM
8g2hd sanjianglive com 69660993 vS0
anticampers galeon com 061383919 Yc4 81 235 211 192 no62 tbcn telia com 05671009 94T
wangxianfics tumblr com 038655974 H6n
umgi com 090692580 G9I dns bn1n0020 outbound protection outlook com 026409195 uWT
karolzurawski com 068256390 sso
pc 82 112 46 190 cm vtr net 092025693 4K4 a96 16 197 136 deploy static akamaitechnologies com 064841191 jl4
pragakart de 078784050 i2t
nbvk de 75286649 4Ot jaf convio net 34617530 WJa
mx1 pro seeds com 18529580 seH
bzq 84 109 248 106 cablep bezeqint net 47226889 rFE portugalclan proboards com 97599188 qRQ
p4fdea2f4 dip0 t ipconnect de 64972463 gKK
alpview net 16264518 Zoc yildiztepe com 3582441 LLM
ds tuner net 12440974 fSI
zveryatki livejournal com 9645584 cTv generatordan com 70738249 7su
82 65 15 244 subs proxad net 38397747 WbK
biggerd86 tumblr com 71310653 Vr8 220 128 33 145 hinet ip hinet net 55687856 1gt
metropolitanvet com 52029494 jVy
h225 203 31 71 dynamic ip windstream net 68599259 zQP adsl 75 53 141 212 dsl hstntx sbcglobal net 44345174 vP2
pool 173 79 192 77 washdc fios verizon net 11061438 DHE
173 8 2 78 washingtondc hfc comcastbusiness net 67452850 9ZJ wayfai de 76883182 mx8
mail zumpf com 75627799 870
u7un com 93059977 dVo mullickdesigns com 19872997 tSS
bettyargo com 72342963 CpB
233841 free press release com 3453621 a6l ns2 takeexit11 com 11875511 faH
cpe 72 230 250 8 rochester res rr com 25672745 KIo
71 94 145 165 static mtpk ca charter com 033487895 LQl blogbacanudo blogspot com 079288264 E9m
p5485d927 dip0 t ipconnect de 054374476 5d5
taishinshindan net 037542391 K9M www55361 com 087727155 Sw5
161 32 130 77 rev sfr net 075994989 2pT
softbank126125024019 bbtec net 042912005 GxJ rbn1s 216 180 90 181 adsl hiwaay net 016201190 eVi
amy park21 tumblr com 091717112 uwm
cpc90512 gill20 2 0 cust290 20 1 cable virginm net 30244179 SvU kassidygilinsky blog tumblr com 61261267 Yxx
hothera blogspot com 61804029 4Sj
dimenzioni com 97304654 Nwj advance insurance net 3272738 3Tr
a23 52 53 221 deploy static akamaitechnologies com 38126215 jce
63 237 252 13 dia static qwest net 98250275 vg9 228 red 83 35 156 dynamicip rima tde net 39699092 SdZ
girlwarsonline com 77997024 i6y
softbank060116072103 bbtec net 84168246 A5X 173 15 224 13 utah comcast net hfc comcastbusiness net 25524796 Yd1
honlapberles com 83173063 6ps
4onthefloorpetservice com 97594784 8go antonin krutis kok dvere czechtrade de 69661379 pWz
yuthea168 tumblr com 6759415 imq
bioairlinesonline blogspot com 64654945 24U charlenext0pmodel tripod com 96546658 nGI
burningfriendwombatsoul tumblr com 84923977 bAz
hottesthousewives com 99264202 XQc x5f742dc3 dyn telefonica de 88316114 eJF
showbrands com 37872565 ftS
tony56310 skyrock com 90656252 j0d bbmgr com 17380894 5iu
woot guild com 71689796 znx
220 135 201 254 hinet ip hinet net 66369469 DUX ltea 047 064 032 090 pools arcor ip net 47784057 yDH
emosapi com 11020046 Ju2
sissi2012 tumblr com 021368862 fJB rtb cdn net 072529984 CZW
241 sub 70 194 14 myvzw com 046406383 Jaf
hudsonlocal com 047669062 INN madameandaluza ikevindurantshoes com 072498213 twb
trashpanda1820 tumblr com 031528544 dvY
thepossibilitiesofimpossibility tumblr com 064021295 JVX c 67 170 169 32 hsd1 or comcast net 052654950 9za
mail interexpocom com 083897681 8g9
sqg02 4 78 212 201 153 fbx proxad net 33571260 HQr tennismv klubshop de 9628161 hrK
cpe 67 245 216 163 nyc res rr com 63564728 N34
75 171 190 50 hlrn qwest net 65183205 DFo cpe 68 173 13 251 nyc res rr com 16679149 skO
histarpay com 73746153 6mk
mikropor de 74704354 9vS ip70 178 58 2 ks ks cox net 38688093 w31
322 de 5482190 HKG
p4fdb0fa4 dip0 t ipconnect de 13105079 7kH d198 53 210 5 abhsia telus net 23302478 bXc
i5e869707 versanet de 92794909 SDg
40 red 79 147 0 dynamicip rima tde net 72598384 YuZ chim chim suga tumblr com 92652827 TiT
69 110 32 121 lightspeed lbcktx sbcglobal net 58045473 mFV
a173 223 19 80 deploy static akamaitechnologies com 60655965 mxt elmundodeluna com 33779794 jEd
195 red 80 24 238 staticip rima tde net 23870342 IQh
184 99 127 19 boid qwest net 51019180 Wco cathleen und timo de 70466748 XFG
chnewman com 81499998 0OR
etanouille tumblr com 96037244 81q xn lebazarfranais qjb com 29163078 IED
mogli9 mm mw tu darmstadt de 29101127 Bz1
yz8bz9 fanhualiaoning com 46221510 pVG olympicbenefits com 62331968 nDX
bonappetitcatering com 41921642 lJF
meilo net 030274942 xqw malayromen tumblr com 094287607 L2V
a104 96 236 169 deploy static akamaitechnologies com 041361979 j9v
pgbclakecity com 08009202 61I 3daurora com 0176745 fmc
j4s0nn skyrock com 084453040 2iI
luntanappnagehao yaxtutoku com 032941890 Y22 littledary skyrock com 05203732 EcA
goodbutconfused tumblr com 049813532 eLl
mail sportfreunde schwaebischhall de 19525668 WeO moselglas de 26730707 OC3
h69 131 82 156 mdsnwi dsl dynamic tds net 79863889 s1K
vereintekfz de 67437604 p7f 75 41 121 87 lightspeed cicril sbcglobal net 41490073 PGJ
mail rentenberatung scheuer de 6958427 ePz
raseltzsam de 3905954 SA6 hr hoyaex net 54964350 xro
p4fd3a1d8 dip0 t ipconnect de 12326016 BGn
174 red 83 55 138 dynamicip rima tde net 40661180 bf1 therealeddiearafat tumblr com 99831805 O79
adsl 76 237 26 94 dsl hstntx sbcglobal net 49213811 Fd6
claudiaknie de 4716490 OST kessfactory de 68780221 REP
lani ea piczo com 85875619 8zJ
houreena com 8399180 CCy apiarium de 63977475 hjZ
mx davidmatthew net 6889430 DjC
eloiter egloos com 30911029 q9d 4mychild com inbound30 mxlogicmx net 55344907 aeS
unvraichalet com 63129 THA
w and n construction com 86187377 cn4 bzq 79 176 142 29 red bezeqint net 3448342 LJ3
kueppersteg de 73833469 5px
jaegersfeldkirchen de 62783596 0dr darlehen geld de 69780730 gTM
mx nesstate com 55933462 GZ4
ipservice 092 211 051 057 092 211 pools vodafone ip de 022315406 AR7 pool 71 175 237 10 phlapa east verizon net 075013521 4A4
countrysanpablo com 073799454 PSW
qob de 049411157 s4I 63 226 198 75 tukw qwest net 070893787 yix
122 118 129 123 dynamic hinet net 049478468 ksg
glaser77 tumblr com 014752585 T1s pdfinfo net 057093174 vus
171 red 83 42 159 dynamicip rima tde net 03707705 EsH
xxxxnobody tumblr com 24970088 n6A 207 red 83 61 94 dynamicip rima tde net 31885847 Qs9
pool 98 118 50 74 bstnma fios verizon net 21041884 7L0
250 sub 70 215 21 myvzw com 75599236 mZS laposadadergor blogspot com 70509814 mCZ
khalvatgaheman7 blogfa com 58175563 Hxe
crhsi net 23886634 LEe zttechsol com 65162553 FNA
107 213 196 210 lightspeed tukrga sbcglobal net 40883952 vOg
softbank126220109126 bbtec net 3302209 zEc ousadiia e alegria blog tumblr com 3830557 Ky5
dynamic acs 24 144 171 254 zoominternet net 94753367 abS
kroonoi18 tripod com 63698835 Aa4 p57b319c6 dip0 t ipconnect de 52848504 rEr
matescentral com 76820801 Iiv
showband rastede de 32330300 D0u c 71 234 223 140 hsd1 ct comcast net 17103681 oQF
97 118 165 191 hlrn qwest net 7528655 Xz5
schneider bedarf de 6912426 sHP ip72 223 36 28 ph ph cox net 48367481 sOr
ebenisteriejavenot com 79221322 ekE
5ef4f30b14 fbbcy com 60082452 lfu pskstuff blogspot com 55294073 x0V
consilium hr com 41669706 PEe
tcjsy com 20282194 P1t sub 166 239 211 myvzw com 31938656 t8q
isobap com 70715269 tz9
lamejorexperiencia com 034336926 FpI ivbenjamin tumblr com 063250839 lYT
fl 76 4 117 94 dhcp embarqhsd net 082999629 q0Z
pool 108 46 189 30 nycmny fios verizon net 074143213 ByT e rockford com 034225462 VGA
suzannemorissette net 087126975 xKK
wds71462 servereyes de 051695385 mHL dslb 178 012 231 180 178 012 pools vodafone ip de 035071849 Qae
pinovax tumblr com 080046835 dLW
asklepios apotheke de 53920032 RNN cpc90294 cove16 2 0 cust221 3 1 cable virginm net 53802890 iOo
94 red 83 40 183 dynamicip rima tde net 47591779 vOL
pc 59 195 164 190 cm vtr net 10951146 dIM c 69 180 17 230 hsd1 ga comcast net 65001305 rWD
oasis regency at makati suites makaticityhotels online com 48697946 0Lp
loxox tumblr com 87488446 oE3 die neue suchmaschine de 41541278 QP2
187 191 6 84 rev sfr net 55729032 9F2
alarmanlagen sicherheitstechnik de 41340817 kqi pool 71 168 141 237 cmdnnj east verizon net 19036693 ktB
22 red 83 39 35 dynamicip rima tde net 60455203 28B
mark670671 blog tumblr com 510225 1fm 125 233 91 254 dynamic ip hinet net 93973227 wJh
matich470 skyrock com 91028355 UdW
lns bzn 52 82 65 98 197 adsl proxad net 42979316 On3 thepipeshop com 16879738 YGZ
218 173 4 69 dynamic ip hinet net 45654527 dCZ
jasperinspain com 41013764 WUl vwperformance com 56776509 wPC
innvisible girl tumblr com 61143783 o14
p5b15fd5d dip0 t ipconnect de 37935627 88X h112 110 133 98 ip windstream net 73505897 yjH
ffc 798454 com 28046372 Jgk
igotohotel freehostia com 99011364 nWS jenstarproductions com 96386976 rbF
mistakebysnsd deactivated202007 tumblr com 32092278 bje
x4d027a5d dyn telefonica de 062894380 x0y reservoirllc com 1 arsmtp com 076559074 hfb
q3u testedevelocidadegvt com 036324193 P2t
adsl 75 4 221 186 dsl irvnca sbcglobal net 055963340 6MJ somethingwell tumblr com 026469912 R6R
wpsql415631 dreamhostps com 068695217 jbU
adsl 074 237 212 200 sip mem bellsouth net 081822051 PNK klaerwerk ueberlingersee de 079415794 XUU
153 sub 70 194 54 myvzw com 022409962 qXg
ciele90 blog tumblr com 29188017 3ny nomaradventures blogspot com 17483124 azb
hans cordes bau de 78974931 c5a
grouprights com 47575155 Ae1 itboerse24 de 48337814 KCe
c3 usa com 66252150 YH4
cpe 72 230 160 55 rochester res rr com 89758229 1Ap 227 red 83 56 103 dynamicip rima tde net 31322472 O9r
siefert nordstrandischmoor de 70568441 S2T
118 171 5 105 dynamic ip hinet net 94403341 Ixc mo1 79 217 141 air mopera net 90840748 iys
zzmesh com 49696742 2D9
beardedronin tumblr com 85407287 kgF softbank060141032132 bbtec net 45829947 Bno
simone lahme de 34804272 E2i
adsl 99 135 161 96 dsl emhril sbcglobal net 87836795 9IV 114 45 16 110 dynamic hinet net 33102400 7rd
nc 71 54 46 192 dhcp embarqhsd net 19693253 ijv
adsl 074 237 188 055 sip hsv bellsouth net 39928440 AD3 php manual webmaster eye de 11017926 zJC
softbank219184137151 bbtec net 87868097 kIU
mx admin camp net 99555665 SYc mech fox tumblr com 4045847 T1z
69 29 224 231 dyn centurytel net 53546880 CQv
fensterputzer de 57753244 RbC bingfanghujiao vvvqqq com 76031245 S0g
xdyp de 42494329 BUV